DPCstruct | MC63981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 150 ± 25 aa |
| Standard deviation of domain lengths | 25.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645GGN9 | 1-147 | MTETNLVKTLTSIQNTNDDVYLVEGNWPLTNVPLLAGKNCFDSTQVYPDPEKWRTVDPSEQYETVYNRFSHISLNLITDQTRFRLQS… |
| A0A3N5M0Y9 | 63-176 | NALLIANGVPALSGQQWVGPDDDNWWILDPDGEAEDQWNRGAAYIVVTPVPGLPQPFITASRVDVIEIQVDPCDASLDSLDVARMVS… |
| A0A087BLP6 | 53-228 | None |
| A0A1H6VMT9 | 727-873 | None |
| A0A522EY37 | 235-406 | None |
| A0A563CBS7 | 387-547 | None |
| A0A5J5DV70 | 695-861 | None |
| A0A850DPZ5 | 1-111 | None |
| A0A7W0YBJ0 | 1-108 | None |
| A0A6J7K2D9 | 24-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.