DPCstruct | MC6398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1FKJ6 | 4-117 | KVIEIFDINKGKVIMNVQLNTDLQQEVKKFLKGITGIYVKFKPIPDTGFMIRIPLEPNIMMKYQSFNALVDEVIIIFSGQENPYLMV… |
| A0A1Q8UTM3 | 13-135 | LSITTVASAQPSKQIEVFDIEKEQVVKSIPSSKEIQQEAKSFINEVTNIYKKFDPIPKRGYMVKVPLEPIYKVENQWFNDFVNQVII… |
| A0A1H3NE17 | 1-101 | None |
| A0A1H0PP04 | 19-141 | None |
| A0A1H3S415 | 88-216 | None |
| A0A3Q9IER9 | 18-132 | None |
| A0A2S5H4D4 | 52-178 | None |
| A0A329L716 | 36-153 | None |
| A0A1Y3QE34 | 1-118 | None |
| A0A7X8MHQ8 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.