DPCstruct | MC6397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 159 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4LG70 | 168-334 | LLLPLVVIASVAIAASYFHSACYRESITCQNGMMVGMGIGMLAGFMVGAVVGATNGMFIGSVLGVAVGEVVGVGLGRHCGSMGALEG… |
| A0A1Q8TTT9 | 5-171 | YYYILISLLLTMIVMIIISYLLKEKLLPMHRMIVSMTVSMNIGLTGGVLFGVLYQGELYFSTIISMFFGLLTGVLCGIFLSIFSAIE… |
| A0A3R9P3L4 | 2-152 | None |
| A0A248TJR0 | 2-182 | None |
| A0A559K442 | 1-136 | None |
| A0A2H9KYW9 | 110-276 | None |
| A0A2T0LEX7 | 6-167 | None |
| A0A1C0YC40 | 1-178 | None |
| W8YTA5 | 112-281 | None |
| A0A542RLQ8 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.