DPCstruct | MC63960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5MZW1 | 14-113 | VEWDPFYHADDPNYPLLHKLLAVPAIRQRYLAHYRTILKEVYNPAFLHPVIDAYAALVDSAVKADPRRPVSYEAFTAAVASLKDHVT… |
| A0A800E687 | 1-104 | MDPLKLADEERAALSSKMLAVPAWRAKYLDHCRELRDTWVNWQKVGPILAGWRKMIEPIVAKDDKGLYGYDAFKDALGEGSGRTPGL… |
| A0A7X9Q797 | 1-136 | None |
| A0A832C4J3 | 381-480 | None |
| A0A353ZGM9 | 1-126 | None |
| A0A359M230 | 61-186 | None |
| A0A7C3NRY9 | 139-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.