DPCstruct | MC6396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 176 ± 27 aa |
| Standard deviation of domain lengths | 27.01 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 18.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8TPP8 | 25-204 | LSDKEKELRLEYMNFQKEHALLLKELQPFVLQISDQVLGKILDHVFKFQMLEEIATKHSSRERLYEVFQYYLKSLFSGEINDAYLLQ… |
| A0A353MBB0 | 15-180 | TDGEITRRKDLVGLGIDEAASLLDCKALIEEEIETIVDEFYQVQTSDAEISLLIGDAETLRRLHSVQRQYVIDLFSGNTDTNYVNNR… |
| A0A662HCD3 | 14-174 | None |
| A0A2N6AUZ4 | 6-151 | None |
| R8BXI4 | 5-113 | None |
| A0A5N6G159 | 15-224 | None |
| A0A257WR25 | 21-175 | None |
| A0A3M1TAS9 | 9-173 | None |
| A0A542QTQ3 | 2-171 | None |
| A0A815UR85 | 2-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.