DPCstruct | MC63959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 157 ± 26 aa |
| Standard deviation of domain lengths | 26.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565FAY8 | 20-167 | ETLLRTDPEKYGYQAGLSRLQRFLSKIQYDWSLRDYIGRKVFEGGYVRLQPNIFSSSLTERLFHACCSLDYVEARRAAEHRRKLLSG… |
| A0A1E5X8V3 | 8-134 | EYSWLKPLNDLRNYIRARHFDPSARCWLSRTVNEQTGEIKIAPNSYSPEFTRELLGILLTIQLDEVDEAARLGIEPRFQVLSLQQLI… |
| A0A0D7K482 | 99-242 | None |
| A0A810YHD8 | 5-139 | None |
| S5ASG5 | 307-525 | None |
| A0A6F8V7J1 | 1-150 | None |
| A0A7W2PTS4 | 283-479 | None |
| A0A8A9AF88 | 11-159 | None |
| A0A377USI1 | 300-456 | None |
| A0A7Z7FRI6 | 5-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.