DPCstruct | MC63958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 216 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 16.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF20747- PF03406 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2I4G3 | 32-147 | GHNKFTYKNKPVAMRDKDGRVTLTLTADAINVNPDYPALAIRRGNTVTLRMEINKIGEGTTLTTLPVDMRPTDQQVFTSISNDGTTS… |
| A0A823KZ80 | 1-109 | QSVTLTPKNGFVASQTLVARYVKFGNRFLVLVGGIVGKGTGTGTGVCATTPTFLAPDTGWNKLYSAAQQSTAASNQANIYLSSGGDI… |
| A0A371JC84 | 110-243 | None |
| A0A318EQP6 | 546-679 | None |
| A0A351CQI5 | 441-547 | None |
| A0A1E5KVN5 | 20-148 | None |
| A0A1H9U1U6 | 71-197 | None |
| A0A410X0H8 | 1099-1216 | None |
| A0A2W5Y9B3 | 15-122 | None |
| A0A1M3EW56 | 80-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.