DPCstruct | MC63955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 98 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2HMS9 | 5-101 | DLSKNSKFNALTRDVVPYKGFKFHNIIGNTTDSTDKSVMTDDVVPYQSAELKGAISEEIIKGGHSIQETPEAVLELRRILRLHLTEL… |
| A0A2E0QUB8 | 16-85 | ILPDLPLGHPVALHSIIGNRGRSGPIEDSSDGVVEYWSSHLDDVDSEVIIPHNHRCLDKKETIEEVFRIL |
| A0A645IIQ9 | 34-140 | None |
| A0A2V7BGH9 | 17-112 | None |
| A0A2V5RX46 | 6-76 | None |
| A0A2V5RB77 | 22-124 | None |
| A0A2V6CEL9 | 54-149 | None |
| A0A7W9WP58 | 492-599 | None |
| A0A2V6GNL4 | 390-504 | None |
| A0A855HHP9 | 106-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.