DPCstruct | MC63950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 265 |
|---|---|
| Mean domain length (aa) | 277 ± 53 aa |
| Standard deviation of domain lengths | 53.17 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.16 |
| Pfam Score | 78.92 |
| Assigned Pfam label(s) | PF00384- PF18364- CL0344- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4MMG0 | 7-271 | TWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLKYPLMRKRLMKMWREAKVQHSDPVEAWASIIEDADKAKSFKQARGRG… |
| A0A4P0YBI4 | 2-276 | QFAPSICQQCSIGCNISPGERYGELRRIENRYNGTVNRYFLCDRGRFGYGYVNLKDRPRQPVQRRGDDLITLNAEQAMQGAADILRQ… |
| A0A7Y4J0Y2 | 95-361 | None |
| A0A2T2UI81 | 54-391 | None |
| A0A379FIL2 | 38-287 | None |
| A0A3B4E335 | 247-585 | None |
| F6DF47 | 20-404 | None |
| A0A5C7N2P0 | 9-338 | None |
| A0A6J7RHG9 | 4-334 | None |
| A0A3M1I7G5 | 2-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.