DPCstruct | MC63949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 317 ± 35 aa |
| Standard deviation of domain lengths | 34.89 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 53.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P0Y518 | 1-368 | MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGMEYAWFNNVESKPGVGFPNDWENQEKWKGGWIRKINGKLQPRMGNRAMLLGK… |
| A0A377D117 | 1-259 | MGNRAMSLGKIFANPHLPGIDDYYEPFDFDYQNLHTAPEGSKSQPIARPRSLITGERMAKIEKGPNWEDDLGGEFDKLAKDKNFDNI… |
| A0A2E7XC36 | 1-337 | None |
| A0A1J5Q5R7 | 4-278 | None |
| A0A533IW78 | 1-328 | None |
| F9EIH6 | 1-325 | None |
| A0A0C2MKV8 | 2-316 | None |
| K1YAQ7 | 1-261 | None |
| A0A1Z1WSB6 | 566-890 | None |
| A0A2S3U597 | 10-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.