DPCstruct | MC63940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 107 ± 21 aa |
| Standard deviation of domain lengths | 21.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7P8U4 | 28-128 | LVDRDLTGVDFSTCAFLPVRILGNTPEYFGTIAAAYSAAVNGEIIQCQKGYFAEHLTLNRDVKVTLEGGFSCNYGSRSGGSSVSSLT… |
| A0A2N3AL43 | 24-187 | PTSYTITSTAGTGGNITPTGLISVTEGGNQTFTITPDICYQIDDILVDGISEGSITTYTFTDIQENHTIQVSFVVIPGPRVLNTTTG… |
| A0A7Y7TIS5 | 495-626 | None |
| A0A7Y7TIW6 | 469-553 | None |
| A0A6I1KHN4 | 431-518 | None |
| A0A399I2F2 | 293-405 | None |
| A0A399I9G6 | 535-664 | None |
| A0A7Y7TFL1 | 747-869 | None |
| A0A3D1LFQ7 | 250-381 | None |
| A0A1T4KGF6 | 897-1032 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.