DPCstruct | MC63935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 165 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5FLD7 | 1-168 | MNRLIGEHDKEERETMRPAIEARHRHYGYDAKTAKDQMAGSFVGRLRMGGEITDQQYQAAVLYLDVYHEMQIAVGGPKPSGAVNLNA… |
| A0A336NC77 | 2-135 | RAKRFGLTIEEAKNPLAGTYVGRLCLQGMLTQDQYDAAQKYLEVKNDYLCAKVYQALFMMKYHHLLMNKAREKWVEFATEQFSNMQE… |
| A0A6M1SYD6 | 1-185 | None |
| A0A6P1YIX2 | 5-156 | None |
| A9IXZ3 | 81-255 | None |
| A0A0H3M6T6 | 25-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.