DPCstruct | MC63933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 125 ± 9 aa |
| Standard deviation of domain lengths | 8.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0PG05 | 13-135 | LIEAMKAGGGGDAPENDAEALLYARQLTAADSTDLILIADNYTFPRDAKLLKNTTAHVRIILCGVHDYINPRYLALARKHGFSLHTI… |
| A0A2N0A005 | 208-341 | QKLKVYEELEKLAKATISGGYGGDGPENDIEALIKAQEVCPDCKELILIADNFSTMRDYSLMGKIQKPVRVVLCGSYAGINTEYLDL… |
| A0A820BUS7 | 136-266 | None |
| A0A819VW88 | 17-149 | None |
| A0A2H0G6H7 | 350-467 | None |
| A0A6C0GD22 | 264-388 | None |
| A0A815B1P6 | 380-507 | None |
| A0A813XTY4 | 556-683 | None |
| A0A7T9DPJ2 | 2-126 | None |
| A0A817BR41 | 218-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.