DPCstruct | MC63931
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 216 ± 34 aa |
| Standard deviation of domain lengths | 33.69 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.32 |
| Pfam Score | 63.24 |
| Assigned Pfam label(s) | PF06276- CL0016- PF11575 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4X8W9 | 55-240 | PGELAVPVDSLFALDPHGQPRLRQWVALAQGVDDAPALLRFIHDYLAIVVPGLLGMYLLYGVAFQPHRQHSLMAINADGQPGRLLLQ… |
| A0A377ANN0 | 1-162 | MTLAQWSSPNALSSLLAVYSDHIYRNQPTMIRENKPLISLWAQWYIGLMVPPLMLALLTQEKALDVSPEHFHAEFHETGRVACFWVD… |
| A0A2V1BU79 | 197-420 | None |
| A0A2D6JJZ0 | 217-453 | None |
| A0A3C1ETB6 | 1-285 | None |
| A0A086CZP1 | 2-164 | None |
| A0A1H0AK99 | 158-358 | None |
| A0A7Z7VRB3 | 17-251 | None |
| V9GAU2 | 343-549 | None |
| A0A514XNX3 | 12-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.