DPCstruct | MC63929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 396 ± 48 aa |
| Standard deviation of domain lengths | 47.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13815 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9X4E2 | 122-553 | ARVTQLCDESAPAPAFCFARRDTPFDWRQLTALSVEQIRRDTDVAALDRVLDTVAFGDAAANDLRDVDPNVLKVLQLAQLTIEYLLH… |
| A0A384BBN8 | 2-343 | NITFCKLEDEKCPHCQSGVDPVLLKLIRLAQLTIEYLLHSQEFLTSQLHDLEERLRLSLAESEQSKKLLTKQAGEIKLLKEECKRRK… |
| A0A819NT45 | 1-335 | None |
| A0A7I4CAS0 | 94-583 | None |
| A0A5J4VSX4 | 6-403 | None |
| A2FWH5 | 9-373 | None |
| D8LJD7 | 3-430 | None |
| A0A4W3ISB3 | 13-388 | None |
| A0A672KGG6 | 12-370 | None |
| E2RDU0 | 5-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.