DPCstruct | MC63928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Standard deviation of domain lengths | 16.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09774 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9X1G9 | 9-153 | QDALADPSVCTDLGFFKRVLRLSRQLDDNLIPRLNALTTRAPDRHESCEAFLAQLAQSYAARNHLIQRCLHRADADLAQASSSASPS… |
| A0A168MRZ3 | 2-109 | MKELRKVDDNIILGLNSTDTHSENACGEFFNRLATAYTKREDAVDYCLKAMDDEIDRKSALLQQDPDDQDLQSSLFGDETKRRLIAN… |
| A0A0V0WCN8 | 4-141 | None |
| A0A0D6ETT1 | 7-173 | None |
| A0A044TSQ3 | 94-232 | None |
| A0A7E4VZA8 | 45-176 | None |
| A0A5C2T699 | 19-183 | None |
| A0A6P7DKY4 | 4-136 | None |
| A0A1Y1XVD6 | 8-137 | None |
| F0ZVZ8 | 20-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.