DPCstruct | MC63923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 324 ± 47 aa |
| Standard deviation of domain lengths | 46.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7A842 | 1-339 | MGSKQQSSKAFASWNTSSRVPPQPQAPSPPSPLPLPEVLTEATKTEKQLFAAAVFRTPETLASKSCNLKTSSEDFQCRERDLVKALP… |
| A0A4Q4ZEV2 | 24-269 | QQPRSKKAMDIRIHELTDGEVRQLTGLLSRRPSFGIGRPSKRWFEHQAKLMSRLPAALMRPNNPLKRLVVKYGDAIGFDRPLFEYPP… |
| A0A1V6RXZ2 | 12-367 | None |
| A0A1L9RIQ0 | 62-436 | None |
| A0A420YBG5 | 3-327 | None |
| A0A6A7AUR0 | 3-331 | None |
| A0A6A6BGY1 | 1-306 | None |
| A0A0F4GUN1 | 6-362 | None |
| C9SED1 | 1-248 | None |
| A0A0G4M472 | 6-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.