DPCstruct | MC63922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 41.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9UJ28 | 87-194 | NGILQLAASVIDLIKRFFPDSIDHDLSRERAEIGGPKPIVDGEFNKNSFSTVKFGHSQIIIVRDEEAKSRLKKLIGEGALVMTVYDA… |
| U9TRY7 | 929-1039 | LASSVIDLIHHFFPDSIDHLSRERSEVGGPRPIVFKGFQAETFLFDVFSVDERMPNCSEFGAEQVIIVRNEEAKKSVGNVGIVMTVF… |
| A0A1I8IKN9 | 642-753 | None |
| A0A397VVU7 | 7-119 | None |
| A0A453CV31 | 306-400 | None |
| A0A6J1B243 | 706-806 | None |
| A0A397TU00 | 176-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.