DPCstruct | MC63921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7A5G8 | 5-84 | ALGRNVHVYSVRYTNTVLGSLFATNGVTNTNLYSMVEIAFIFDNGYTLCGESGTTVQWDDHPLPEDRYPMNTAGSLRVKN |
| A0A1B8E3C4 | 95-178 | RNVNVYDNDGHVLGGLYQNGSLTNLNLYEMCAIFVITAEQFAIFKLHGDGSTGPKIFLNKDRLLAASYVILTDDGQPNSARITN |
| A0A3N4IU15 | 1-78 | None |
| A0A3N4IYB0 | 6-86 | None |
| A0A2T6ZC60 | 28-107 | None |
| A0A2T6ZK50 | 12-99 | None |
| A0A1C7MMR3 | 5-86 | None |
| A0A0J6YFR2 | 128-218 | None |
| A0A094GEN2 | 4-99 | None |
| A0A2T6ZTK5 | 6-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.