DPCstruct | MC6391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 125 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F1IBU6 | 112-244 | PEPRPVGAAIRSMDQRTWQALTTGSVALPRHRVHAGLWFRLLRTLLDELGATIIECGAPGRLTRQVWDRTGHPVRAGQGPWRPYEEL… |
| A0A0U3R5A2 | 14-139 | LAPQPAPQHILALDQRTHDAFTLGQVDLPRRPVHAGIWFRLLRTLIDELSRPLSESRLAVTATIRQIWKETGYPTRDGQSIWRPFEQ… |
| A0A1I7DIM7 | 4-120 | None |
| G9EIL2 | 1-127 | None |
| A0A260LPG9 | 8-104 | None |
| A0A1H3CXN0 | 109-237 | None |
| A0A1M3M086 | 36-167 | None |
| C7T592 | 304-435 | None |
| A0A5S4FIA1 | 624-751 | None |
| A0A239GVL8 | 73-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.