DPCstruct | MC63904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 238 ± 20 aa |
| Standard deviation of domain lengths | 20.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 92.50 |
| Assigned Pfam label(s) | CL0264- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8FR25 | 1-229 | MIISTTRPEQAPQTSQFQALVPGVVKTRSAAGKHVIAVDFTKFPTALLRDGNHPTDGGYRTMGDWWYDFMTQIPPSWISVPEGPDPV… |
| A0A2A2D774 | 260-456 | LVPSADAGTQQRIEKFNAVIPQLVAERQAKGRHVGFVDMGAVTTQDLDDDLHPKDSGYVKMADAFSNGVARAAADGWIKQRVDIKPG… |
| A0A5N5PHE6 | 180-426 | None |
| A0A1V8SWN9 | 161-407 | None |
| A0A1B8G6W4 | 74-326 | None |
| A0A5N6SVQ7 | 184-446 | None |
| A0A0D2XXQ5 | 86-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.