DPCstruct | MC63897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4R9W4 | 299-438 | ALEVGGLEFTACPFNGWYMGTEIGLRDFCDTGRLNVIQDVGKRLGLDTGNVTSLWKDQAAVEINIAVLHSYQSDKVTIVDHHTAAES… |
| A0A1Q7W8T2 | 62-189 | SSRCIGRLYWRTLRLRDRRADADRYDLLPTVAANLGLDTGSDRTLWRDRALVELNLAVLHSYEQAGVTIADHHTESHRFLTHLDKEA… |
| T0LHN1 | 20-148 | None |
| F7DLC7 | 332-477 | None |
| A0A6P4EAF3 | 39-178 | None |
| A0A352AP46 | 536-679 | None |
| A0A7R8XD72 | 74-191 | None |
| A0A1S3IG29 | 203-343 | None |
| A0A4P2PVW9 | 1027-1156 | None |
| A0A326QQ14 | 756-899 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.