DPCstruct | MC63896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 379 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 17.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 99.18 |
| Assigned Pfam label(s) | PF04122- CL0159- PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838HWJ9 | 2-85 | ATAVAITRAAYPNGADVVYLARADDFADALAGGSLSDGPILLVPACGTLPTVVADEIRRLDPQRVVALGGTVAVCDEMLAQAAA |
| A0A1Q7W895 | 11-126 | ALNSIGVKHTALVGSDRYQTSYLVAKTFFGGWEDNGTPPAAVGFATGLTWPDALSGGAFMGQHRGPLLLVDPVNGISPDTQLWLAGW… |
| A0A7L5ADR0 | 51-169 | None |
| A0A7L5AP23 | 125-237 | None |
| A0A259TKX4 | 20-200 | None |
| A0LUZ9 | 158-271 | None |
| A0A2V2EA18 | 2-137 | None |
| A0A2V2ECB9 | 100-241 | None |
| A0A2W1W5W4 | 461-583 | None |
| A0A7X8FQE0 | 14-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.