DPCstruct | MC63895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 16.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.77 |
| Pfam Score | 98.86 |
| Assigned Pfam label(s) | CL0042- CL0161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7W290 | 126-214 | EPDRLHRGLQGARFTATTLAGVRRRGWSQSVAEREQGVASVSAPVRGPNNRVIAAVSVSGPIERLTRQPGRLHAQSVVEAAARLSEA… |
| A0A268HXN9 | 14-105 | PEEQRVDYLEHVLLKPITPHTITDKETLLARLQEYEQLGYAIDDEENEEGLYCVAAPIFDASKVMQAAISVAGPKERMLRQKSQIVN… |
| A0A2S8U0S1 | 64-148 | None |
| A0A7X5WWM8 | 4-99 | None |
| A0A516PVS6 | 112-214 | None |
| A0A2E2RK33 | 58-187 | None |
| A0A248UNN9 | 143-249 | None |
| A0A7W1J435 | 75-162 | None |
| A0A349WC40 | 21-114 | None |
| A0A1H0V1E4 | 204-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.