DPCstruct | MC6389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 29.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3RD58 | 36-101 | CEGCVCDQLRRLRMQTEVDVFLKGGRRLNNVFFINFDRDTCCAIFTDNGSTIIVDCQDIQAIRIER |
| A0A1H7VRG2 | 399-461 | LVRLFESLPSNYPVRSIITNGTEIYVSFFIQYVPDQQLVYFFDDENVISIESHRIDGIIFAND |
| A0A511Z4W6 | 183-245 | None |
| A0A2N5MG84 | 73-138 | None |
| A0A0M2PFR9 | 2-68 | None |
| A0A1I5XVD2 | 357-418 | None |
| A0A4R2BJ89 | 3-79 | None |
| A0A4R2BGG6 | 23-84 | None |
| A0A4Q9ZM91 | 13-77 | None |
| A0A6B9YAW9 | 233-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.