DPCstruct | MC63883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.50 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0036- PF02792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6E8C6 | 1-82 | MPREPTLQTLHIASVAFNSLLLGEIFIPDWDMFHSKHESAEFHGAARALSGGGVYVSDKPGVHDFSVLKKLVLPDGSILRAR |
| A0A7C4SKN8 | 117-201 | RVSMDYIPFWKADAKLHTIFSFYNALLFGHITYPDYDMFMSYDPYAKVHAVARVFSGGPIYITDREPEKTDMDLLKRFVLSDGRI |
| A0A6P5TLV3 | 495-582 | None |
| A0A7X7ITH4 | 196-275 | None |
| A0A0E0QHU4 | 51-135 | None |
| K3Y5P6 | 575-682 | None |
| A0A7J7QAI0 | 625-708 | None |
| A0A3L6FY07 | 230-309 | None |
| A0A287WEG7 | 21-102 | None |
| A0A7C2S837 | 60-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.