DPCstruct | MC63881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 8.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0TZE3 | 586-674 | SDSTFRKELKSLLSKPYNKKEHDSLMEEVRQRKPLQRYRDLRGGRVATYELEILGQSYLDRHETFAKAIQEFSGDCCKVLNILRGFV… |
| A0A1D6E4H2 | 15-109 | RPNSVFKEKLIEFLIKPFTQEEYDRYFALASDRIPMVKERRTRNTVAYYHWTHEMSKSYFDRYPDLAQQFSLQRNNYTNGLALLRGL… |
| A0A835R3F0 | 249-349 | None |
| A0A068UTR2 | 1-91 | None |
| A0A1D1YKR8 | 224-322 | None |
| A0A3S3PUZ7 | 4-92 | None |
| A0A0A8YJX5 | 56-147 | None |
| G7IK21 | 422-516 | None |
| A0A1D6E4G9 | 121-210 | None |
| A0A287FYC3 | 63-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.