DPCstruct | MC6388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 11.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0063- PF20157 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4G3Y6 | 7-130 | EVHDWETPASKYPLKRLGSAEIWRGRYKRGLYLMEGVAGYVFFHVTKPINVTALRIHGKTVMVDDPLHWIGMKLLAEHCSGRTLIGG… |
| A0A255HRQ4 | 10-117 | HSLTAKYGFGLFPLPAYRPVSQGEWRITTHLPTMADGYLATTSFEANAVLKKGRAVWMSTCLLEQESHSWHVHCAQGVVVVAGLGMG… |
| A0A4Y7RJ14 | 544-679 | None |
| A0A417MYJ7 | 104-228 | None |
| A0A0F9PZ25 | 5-131 | None |
| A0A0F9SQS0 | 1-124 | None |
| A0A357HCQ2 | 87-227 | None |
| R6W9T9 | 11-145 | None |
| W3ARZ2 | 93-213 | None |
| W6S3U1 | 13-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.