DPCstruct | MC63878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F1B2J7 | 8-88 | KFKKEDSTYSKDLADYAVSFIECLTHTKGTWAGKPFKLLDWQEQIIRDLFGVVKPNGYRQFNTAYIEIPKKMGKSELAAAI |
| A0A401UTE0 | 1-64 | MFDENKVERAAEFIRNLKHTKEIWHGVPFDLLPWQDRIIRDIFGTVKDNGFRQYNSAYVEIPKK |
| A4W9F1 | 5-88 | None |
| A0A6N8HUK8 | 13-96 | None |
| A0A380FDX3 | 3-85 | None |
| R9IVY1 | 7-95 | None |
| A0A0F9EY70 | 44-124 | None |
| A0A2G4IMA1 | 23-101 | None |
| A0A1Y4C5B0 | 26-110 | None |
| A0A376VJ43 | 43-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.