DPCstruct | MC63871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W2CU20 | 3-89 | EFEAAVKEAKLNPKEVSGKLYIHQSNPRGACPACIAGITNPDAKSGIFLEFSKMYPKLEIVVTSEIVEGKKAVGRQFFRLKNGKYIE |
| F0FD13 | 1-77 | MDPEKVKGTLEMHQSNPSGVCISCISGITNDAAKEGIFLQFSKKYPDLKIVVTSVEREGVRKVGRLNFTIQNGKYLK |
| A0A151YWB9 | 57-141 | None |
| A0A4U9YFD2 | 605-690 | None |
| A0A2P8MEF5 | 290-378 | None |
| A0A1V5LR76 | 138-224 | None |
| A0A073K443 | 1-67 | None |
| A0A151Z0S0 | 436-523 | None |
| A0A7V7LHG8 | 158-248 | None |
| U7V9H7 | 29-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.