DPCstruct | MC6387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 133 ± 16 aa |
| Standard deviation of domain lengths | 16.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255HPM6 | 48-185 | MEMEPEAPSAERLALEKILASAGFSRSEPLSSFLAYVCEAALTQKTIRLTEQHIGIHIFGRPDNYIPAEDTIVRTTAAMLRKRLARY… |
| A0A4D4ITD1 | 12-124 | LANQQHQILIRGQLERIIESSVFEQSPKMKELLSFLVEQTLQGNGDRLKQFTIAIEIFDRGVDFDHQSDPIVRIQAGRVRRSLDTYY… |
| A0A840TB24 | 2-87 | None |
| A0A350UPF1 | 8-143 | None |
| A0A350UJ83 | 15-139 | None |
| A0A2N6C7D4 | 3-116 | None |
| A0A376AF31 | 1-139 | None |
| A0A4D8Q8B8 | 5-120 | None |
| A0A841RFX0 | 2-121 | None |
| A0A6I5YPI9 | 25-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.