DPCstruct | MC63866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 121 ± 23 aa |
| Standard deviation of domain lengths | 22.69 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 17.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A521DMD9 | 1-114 | MTIKNIISKEDGKTIVFYKHRASWIAYEQSAYYLWQTGEYIPEVRHMKYLRKHVVSINFPNTLLPEIVNNLSTFGLIAVEKDRVQIV… |
| A0A242NRA1 | 1-100 | MLIEKKLLLTRQPNRACFIGNGLFCNLYEQSAYIVCELLGVDLKLRVETIKKLNNEKLIVTGFPNAKVLGKFPEAIKTQWGYVLQDK… |
| A0A1Y0MAQ5 | 2-129 | None |
| A0A1H5UHL3 | 1-90 | None |
| A0A2M9V5J3 | 1-87 | None |
| F5IZC3 | 1-115 | None |
| A0A3D2NCH7 | 16-173 | None |
| A0A316N5Q6 | 1-169 | None |
| A0A642PKK3 | 47-163 | None |
| A0A174NR78 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.