DPCstruct | MC63864
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E9PKJ9 | 1-94 | MSLASLEKIGISLDKVEVLTQWGITGIRLDDRFSNEVIAKLTHKIHLGINASTIEENDIKEIIANGADKEYIAAWQNYYPRPYTGLG… |
| A0A091BZZ2 | 1-70 | MRLDLGFTGAEEAQMTRNPYRLKIEINMSGGTNYVDNIMSYSPDTDHLLGSHNFYPHRYTGLGYQHFVYC |
| A0A077ZK10 | 64-171 | None |
| A0A8A6R2D6 | 236-346 | None |
| A0A7X6KYC7 | 61-165 | None |
| A0A243VD93 | 6-100 | None |
| A0A2A8CSN0 | 3-100 | None |
| U4QGL2 | 59-153 | None |
| C9MWS7 | 3-88 | None |
| A0A2U3AIH8 | 68-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.