DPCstruct | MC63855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 10.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 38.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3FBI6 | 1-109 | QIEKTVIHVTTMPTEAIIEKCRQNLRANLSPLIITMSGRAPVARGIAEMAGVSDRIDILAAEQFLAANLHELSAFQIAAREATLREL… |
| A0A3C0KVI1 | 77-185 | LIGDAAIHVTTAPTDALIRKCCDNLNENFRPVIITTQSGAYGAEALARNAGITKRIDVLAVDQFIATNVHEWSKFVLSQRPTTLLQL… |
| A0A1Q9ALR7 | 1-101 | None |
| A0A2W6QA49 | 8-96 | None |
| A0A564VP81 | 36-144 | None |
| A0A455VFY1 | 112-243 | None |
| A0A1G6LKY5 | 222-331 | None |
| E9CNX7 | 20-131 | None |
| A0A0J8YCC8 | 1-96 | None |
| A0A1M7BD35 | 170-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.