DPCstruct | MC63851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A232FLH4 | 3-78 | YLLRPEETLKMAVKLESVHPGRTRYLVVVSCTGRQDAEESCLLGIDCNDRATVGLVLRVLADTAITLDGDGGFSVS |
| A0A0A9X2Q6 | 76-160 | IQYHLQSMFYLLRPEETLKMAVKLESVHAGRTRYLVVVSRLGRQGTEESCLLGIDCNHATTVGLVLKVLADTAITLDGDGGFSVS |
| A0A3L8DSC0 | 81-168 | None |
| E2C1T0 | 1-88 | None |
| A0A6I9YZK7 | 42-132 | None |
| A0A3P7PB44 | 37-125 | None |
| A0A818B317 | 57-143 | None |
| A0A183S158 | 2-83 | None |
| A0A653DMI5 | 1-89 | None |
| A0A5K3EGZ3 | 69-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.