DPCstruct | MC63850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 54.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015NKA8 | 80-147 | GVKWMYGRWLIEGAPHVLLLDTNSIADRLDSWKGDLWNVAGIPSPPNDQETNDAILFGYLVGWFLGDF |
| A0A367JFV5 | 82-148 | GVKYLYGRWLVEGSPYVLLFDTNSVFHKLDEWKGDLWRNAGIPSPQADTETNDAILFGYLVTWFFGE |
| K5UND3 | 436-502 | None |
| A0A368GG93 | 115-182 | None |
| A0A183M0S7 | 135-206 | None |
| A0A1C7MU22 | 82-153 | None |
| A0A1I7VHD2 | 193-268 | None |
| A0A6A4H515 | 82-149 | None |
| A0A7R9J9N9 | 106-174 | None |
| A0A5N5QG31 | 121-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.