DPCstruct | MC6385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 153 ± 30 aa |
| Standard deviation of domain lengths | 30.21 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | PF03461- CL0408- CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380FDC0 | 4-106 | KDELIDRFNEYPVEVERLLDMMEIKVHALHAGVTLIKDTGKQVEVYMSEKGTTEINGESLFKHTQPLGRAMKVGVQDGKMKVTLNKT… |
| A0A7Y3FJY5 | 13-172 | MFVQMLNEAVAELKGEPLQPEIDPELSVEIEHYLPEEYIDDIGLRLSLYRRFATAVDEAAVDELAMEMEERFGAPPPPARAFIRLMS… |
| R6H943 | 7-206 | None |
| A0A7V1ZDE8 | 1-123 | None |
| A0A540VK97 | 1047-1242 | None |
| Q2HRW7 | 12-143 | None |
| A0A376F4X1 | 4-134 | None |
| A0A7N2KZ43 | 455-592 | None |
| A0A656KAV3 | 1-104 | None |
| A0A1A2XIX5 | 3-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.