DPCstruct | MC6384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Standard deviation of domain lengths | 18.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X7YAG8 | 16-124 | VPVAEIAAYWVDRLDRMLTALVRDRDTIGPRRSIDIRFDDFMANEFGVAGQVYALAGEPFDEPARTAITGYLAGHRRGRLGNVETSC… |
| A0A7Y2BIW5 | 4-114 | RPRIALEQKEAWARAVENGMRLRKGREHQFHDIYFDDFMADPIGEVAKAYARFGQPFTERAKEALTAWREAHKPGQFGTHNYTRDDF… |
| A0A7S1FQL1 | 83-221 | None |
| A0A821UV03 | 3-97 | None |
| A0A7K2CA62 | 5-104 | None |
| A0A815DLJ6 | 55-154 | None |
| A0A820RLH7 | 93-209 | None |
| A0A814UKY4 | 8-96 | None |
| A0A820TCQ2 | 6-95 | None |
| A0A661GR36 | 3-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.