DPCstruct | MC63838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 103 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 16.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162XH25 | 1-121 | MTFSTTSLKFDPAGRFVYIVTDTYYPTSADFEDGKGATTIDSVHTTVGGANNRAKKIMFARDNPDNNCEVDEDKIIEEQKGGLYIGI… |
| A0A6G1J3D5 | 160-252 | PAERNVIYNVVEAVNSEYMDDTFQIIGTYKNLHSANLAAAEHMIDEGHWASGTHAGNEPEIALRRDGTLRLEIETDGSMGGLVSVFV… |
| A0A835YB72 | 33-130 | None |
| A0A5M9LCC9 | 1-88 | None |
| A0A2T3ACL5 | 1-136 | None |
| A0A4Z1ID34 | 3-82 | None |
| A0A0T6BM16 | 89-183 | None |
| A0A2J6RZQ2 | 38-142 | None |
| A0A4Z1J2R2 | 155-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.