DPCstruct | MC63837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 437 ± 37 aa |
| Standard deviation of domain lengths | 37.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371K8X9 | 48-511 | IEETEEKNRHKIDNTGENDTDHIIGIYRWLDKFYDVQVFNHGKRMLLEFVVPEPGAFYRYSQATDAAEEVDMEKPTPPKINKRLLEL… |
| A0A645AYW6 | 75-470 | QHITGVYRWIDKKMKNQIYNYGKRTMFEFMVPEPARLHDLATKSARNSFDEPIDPRKAPLPHTMPNGDVDEALIRYWAEQYHVKLDT… |
| A0A395JLN5 | 257-769 | None |
| A0A0D6TMX0 | 332-742 | None |
| A0A1B9Y6V9 | 114-601 | None |
| A0A679HXP6 | 487-884 | None |
| A0A5C8A9D2 | 198-616 | None |
| A0A1I5FJB3 | 408-902 | None |
| A0A5F0DHD5 | 457-878 | None |
| A0A255YVJ4 | 12-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.