DPCstruct | MC63836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 430 ± 102 aa |
| Standard deviation of domain lengths | 101.56 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357KWT2 | 59-485 | RSELERIVERQNRLAEETEDLADDMRRREDELSEKDPGAAGAMRQAAQRAEREQVAQTMREAGAEAGKNQTARAQSRQQQAQEALEQ… |
| A0A847YGE2 | 2-379 | DHARDAAIGARMRTAAAAVDDNRLSQGLQTQREVIADLRELLRRFSEGGIPPKDAQVWRETASRLQDLIDRQLQWRSELESRLQSGD… |
| A0A358Y3T2 | 311-873 | None |
| A0A1V5V0M2 | 86-398 | None |
| A0A3E1EFC5 | 642-1100 | None |
| A0A1V5H450 | 386-710 | None |
| A0A3A4PJN2 | 1-700 | None |
| A0A350PHQ8 | 6-334 | None |
| A0A7V3NV99 | 577-966 | None |
| A0A661G7V5 | 11-673 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.