DPCstruct | MC63833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 142 ± 20 aa |
| Standard deviation of domain lengths | 20.22 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9BF06 | 19-168 | LKELEARHAERFQDTSRDPDHNGKVRFASQEEARIALDLEERGYGPFERPKDADGKLLPKLGDWVDAHGQQWDVKGIHSDWPPHTPD… |
| A0A4R4QJJ1 | 242-362 | VTTEDEAQRRYELGYDPAVKQFRPGETETALRIESERGVQLERAKSADEKYDWVDSDGRTYDAIGNFPAKFLDRQWDNLKEKVEHHL… |
| A0A381E665 | 174-319 | None |
| A0A356FWZ0 | 27-176 | None |
| A0A1G5F9R9 | 229-373 | None |
| A0A7U0HSW9 | 617-767 | None |
| A0A7J9ZAT1 | 480-605 | None |
| A0A0D2JLZ3 | 1088-1218 | None |
| A0A7X9QDI3 | 459-603 | None |
| A0A5A7S7K5 | 295-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.