DPCstruct | MC63831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A9AXJ7 | 1-79 | MPCPPQLAVLLRDHLRQFGADADGYLFRGVRDHGLFAESTYSRAWRKAREAVFTEEEYASPLARRAYQLRHAAVSTWLN |
| A0A561SNT1 | 69-142 | PALTGLLHAHLESFGNGPGGRLFGGVRGGELSESTYCRTWRRARAVALNPVDVASPLARRPYDLCHAAVSTWLN |
| A0A7Y4L2Z1 | 37-125 | None |
| A0A4R5ARL0 | 70-145 | None |
| A0A6I1YQD8 | 1-77 | None |
| A0A7W7D779 | 1-72 | None |
| A0A169PHX3 | 19-95 | None |
| A0A0D8BGJ5 | 36-109 | None |
| A0A1H0VBA9 | 167-242 | None |
| A0A1H4WSE5 | 18-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.