DPCstruct | MC6383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 33.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3LUE9 | 20-78 | VAPAPYVRIPLAAHITGYTEKAIRRKIDEGVWRVGKEYRKAPDGSVLISIAGYARWVET |
| A0A0W0ZTQ2 | 1-57 | MKWVKLKKYCQDTGDTTNAVHSKRKRGMWLDGLHCKLGPDGNLWINLVEVEKWVEFG |
| A0A433MD96 | 52-110 | None |
| A0A1X7DYK6 | 4-63 | None |
| A0A0S4W4M3 | 156-222 | None |
| A0A1S2T5E6 | 1-58 | None |
| A0A2A5CJA3 | 4-65 | None |
| A0A127QZW6 | 30-92 | None |
| A0A432Z3M9 | 94-160 | None |
| A0A1S1UAW2 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.