DPCstruct | MC63828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 175 ± 22 aa |
| Standard deviation of domain lengths | 21.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 87.14 |
| Assigned Pfam label(s) | CL0059- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J1DL83 | 198-381 | VKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGFYQDGSYIDHTNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWI… |
| A0A8A9AMJ8 | 2-154 | QVLALRGVLGQDAVKVALARDALSAAMAQVTSGDGIHPDGSFIQHERLPYAGAYGVDYLTGLGLLFALLAGSTWQITHPDREVVLGS… |
| A0A354U655 | 323-509 | None |
| D4XUV2 | 569-760 | None |
| A0A0K2RCZ6 | 91-287 | None |
| A0A2E9IMI8 | 172-338 | None |
| F3PP21 | 380-553 | None |
| A0A357WHL3 | 136-277 | None |
| A0A2U0SNR1 | 117-281 | None |
| A0A0A6QUI7 | 145-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.