DPCstruct | MC6382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13298 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1H780 | 1-87 | TVMVWDYGTYKPEDTEDVSLALRKGELKFSLNGKKLKGSWVLVRTRERQWLLIKHRDYYTTEEEVTEVAPASILTRRTLAEIAEDEG |
| A0A0W0ZQL5 | 1-91 | MVWDLGHYELIEEKKSMKKALKEGTLKFFLHEEKIKGGYAMTRTKQEKDTEQWVIFKLDDNQADAWKNPVSTKPNSVLTGRSLDEIA… |
| A0A1F5K1B2 | 65-165 | None |
| A0A679JS34 | 94-192 | None |
| A0A2A2M3N4 | 1-92 | None |
| A0A842UZL6 | 9-99 | None |
| A0A1A2GDQ8 | 67-141 | None |
| A0A534PBB8 | 170-271 | None |
| A0A2X3K8B6 | 1-83 | None |
| A0A1E4E4Y2 | 84-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.