DPCstruct | MC6381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 131 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D8I7W8 | 56-191 | YYLEPSFWEFKNICKLDPEIYQFNGGKIDEEYYNKVLKYFDTSLDTLDWESIEKNSTLLTPEYLDYDENNEKYLYSYKIQKSRIKYI… |
| A0A3D8I168 | 1-132 | MPYSFQPSYHEFKKMCKLNELPNNEEKYNKILSYYDLDWNTMFETMKPIQTSDEYQIKYMLGETKIHNRIEFDSGFFVYLDKTKQNI… |
| A0A4V6HY57 | 2-124 | None |
| A0A4U8TEN2 | 1-149 | None |
| A0A4U8S2H1 | 28-160 | None |
| A0A4U8S0Z3 | 28-141 | None |
| Q7VJ52 | 36-183 | None |
| A0A1W6BUL4 | 33-157 | None |
| A0A1S1MDJ7 | 55-189 | None |
| A0A3D8I275 | 26-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.