DPCstruct | MC63809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 187 ± 21 aa |
| Standard deviation of domain lengths | 20.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 25.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507D9S4 | 645-816 | AVNQQLTSIEMDVKMMNATCLEMERELEQANQATAPLMKQAQQLRAKKQRSEVRKTIVEAFLARFTLSDAQISVLTSPKDPVGPEYF… |
| A0A183S254 | 67-232 | DVKKRLDSLDTCINSILETCLRMNGTLTSVKSETVCLVEEAQQLKSDSKVAEIKAYLLELLVGSYQISAKDAQILSSKISHADDTFF… |
| A0A5N5QRZ6 | 275-441 | None |
| A0A7J6R794 | 57-284 | None |
| A0A7R9G8B2 | 77-278 | None |
| A0A433DD56 | 76-270 | None |
| U7Q6U0 | 130-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.