DPCstruct | MC63808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9TYN5 | 2-70 | ISELEKGTISFYKHDDFTDSCRGPHLPHTGFIKTIKLMKVSGAYWRAHQTKAQLHGIYGTTFFTKKELD |
| A0A3S4VX70 | 23-88 | DENIERTATPALYHHEEYIDMCRGPHVPNMRFCHHFKLQKVAGAYWRGDSKNKMLQRIYGTAWADK |
| A0A183RG62 | 54-122 | None |
| A0A7Z9IUU3 | 30-111 | None |
| L2GM49 | 43-103 | None |
| A0A4S4E2Q4 | 1-72 | None |
| A0A6P5N0U2 | 200-269 | None |
| M8BWT2 | 181-246 | None |
| A0A317Y9B2 | 184-269 | None |
| A0A1W4UX58 | 308-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.