DPCstruct | MC638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 169 ± 25 aa |
| Standard deviation of domain lengths | 25.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6BX78 | 1-149 | MVQNKEKYLKAKEFRQRGFTYSEISKIVGISKATVSNWFGKQSFSKKVRKDNELKARRDNVKRVSLVNKARNAERSSRYKEAIKSAE… |
| A0A538KGJ7 | 1-153 | MKTVEREKARAMRRDEGRSIKEIAGLLGVSKSSVSLWVRDIELSEEQDDELQARNGLHERQRLARAAMSANARARRIAWQLEGRRRA… |
| A0A852TML0 | 60-230 | None |
| A0A7V9GEX2 | 5-124 | None |
| A0A7K0BS86 | 233-425 | None |
| A0A2T0QCZ8 | 65-231 | None |
| A0A7W3LZQ7 | 13-208 | None |
| A0A1F6CHR3 | 1-170 | None |
| A0A7M3MQV2 | 1-205 | None |
| A0A5Q4FUY5 | 120-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.